SeqBench

Protease Digestion & Peptide Mass Calculator

Digest a protein with trypsin, Lys-C, chymotrypsin and more, and get peptide masses.

Predict the peptides you'll see after digesting a protein for mass spectrometry or peptide mapping. Paste a protein sequence, choose a protease or chemical cleavage agent (trypsin, Lys-C, Arg-C, chymotrypsin, Glu-C/V8, Asp-N or CNBr), and allow up to two missed cleavages; the tool applies each enzyme's published specificity and returns a sortable peptide table with start–end positions, length, and both monoisotopic and average neutral masses. Filter by a target mass window to match observed ions, then export the peptide list as CSV.

Worked example

Trypsin on the first 61 residues of human alpha-globin. MVLSPADK is its textbook N-terminal tryptic peptide.

Input

MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKK

Result
protein length
62
site count
7
peptide count
8

Computed by this page's own tool when the site was built — paste your own sequence below to replace it.

0 residues · non amino-acid characters are ignored

Cleaves C-terminal to K or R, not before P

Peptides spanning up to this many uncut sites are also listed.

Paste a protein sequence above to see its cleavage sites and the peptides they produce, with masses.

Masses are neutral (uncharged) peptide masses: the sum of residue masses plus one water. Monoisotopic masses use the most-abundant isotope of each element; average masses use average isotopic residue masses. For an observed m/z, add proton mass(es) for the charge state.

Design, edit, and verify complete constructsSeqStudio combines sequence editing and annotation, plasmid maps, primer/cloning/CRISPR design, Sanger verification, and GenBank/SnapGene files in one workspace.

How to use the Protease Digestion tool

  1. 1Paste a protein sequence in one-letter amino-acid code (or load the example).
  2. 2Pick a protease and the number of allowed missed cleavages (0–2).
  3. 3Read the peptide table, filter by a mass range, sort by mass or position, and export CSV.

Frequently asked questions

Which proteases and cleavage rules are supported?

Trypsin (cleaves C-terminal to K or R, but not before proline), Lys-C (after K), Arg-C (after R), chymotrypsin (after F, Y or W, not before proline), Glu-C/V8 (after E), Asp-N (N-terminal to D, i.e. before each aspartate) and CNBr (after M). Each enzyme's rule is shown next to the selector.

What do missed cleavages do?

With 0 missed cleavages you get only fully-cut peptides. Setting 1 or 2 also lists peptides that span that many uncut internal sites — the same enumeration used by MS peptide-mapping and peptide-mass-fingerprint search engines, since real digests are rarely 100% complete.

Are the masses monoisotopic or average?

Both. Monoisotopic masses use the most-abundant isotope of each element (matching the peaks in a high-resolution MS spectrum); average masses use average isotopic residue masses. For enzymatic digestion, each neutral peptide mass is the sum of residue masses plus one water. CNBr is the exception: terminal methionine is calculated as homoserine lactone (−48.003371 Da relative to the unmodified peptide), while the sequence retains M for its parent coordinates. Hydrolysed homoserine products are not included; they are 18.010565 Da heavier. Add proton mass(es) for the observed m/z at a given charge state.

More